PDB entry 1iod
View 1iod on RCSB PDB site
Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x
Class: hydrolase/hydrolase inhibitor
Keywords: calcium bridging, domain swapping, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on
2001-02-27, released
2001-06-27
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: coagulation factor x binding protein
Species: Deinagkistrodon acutus [TaxId:36307]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1ioda_ - Chain 'B':
Compound: coagulation factor x binding protein
Species: Deinagkistrodon acutus [TaxId:36307]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1iodb_ - Chain 'G':
Compound: coagulation factor x gla domain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1iodg_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1iodA (A:)
dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
qqdpfvcea
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1iodB (B:)
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1iodG (G:)
ansfleevkqgnlerecleeacsleearevfedaeqtdefwsky