PDB entry 1ioa

View 1ioa on RCSB PDB site
Description: arcelin-5, a lectin-like defense protein from phaseolus vulgaris
Deposited on 1996-10-02, released 1996-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ioaa_
  • Chain 'B':
    Domains in SCOP 1.67: d1ioab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ioaA (A:)
    atetsfnfpnfhtddklilqgnatisskgqlqltgvgsnelprvdslgrafysdpiqikd
    snnvasfntnftfiiraknqsisayglafalvpvnsppqkkqeflgifntnnpepnartv
    avvfntfknridfdknfikpyvnencdfhkyngektdvqitydssnndlrvflhftvsqv
    kcsvsatvhlekevdewvsvgfsptsgltedttethdvlswsfsskfrnklsnillnnil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ioaA (A:)
    atetsfnfpnfhtddklilqgnatisskgqlqltgvgsnelprvdslgrafysdpiqikd
    snnvasfntnftfiiraknqsisayglafalvpvnsppqkkqeflgifntnnpepnartv
    avvfntfknridfdknfikpyvnencdfhkyngektdvqitydssnndlrvflhftvsqv
    kcsvsatvhlekevdewvsvgfsptsgltedttethdvlswsfsskfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ioaB (B:)
    atetsfnfpnfhtddklilqgnatisskgqlqltgvgsnelprvdslgrafysdpiqikd
    snnvasfntnftfiiraknqsisayglafalvpvnsppqkkqeflgifntnnpepnartv
    avvfntfknridfdknfikpyvnencdfhkyngektdvqitydssnndlrvflhftvsqv
    kcsvsatvhlekevdewvsvgfsptsgltedttethdvlswsfsskfrnklsnillnnil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ioaB (B:)
    atetsfnfpnfhtddklilqgnatisskgqlqltgvgsnelprvdslgrafysdpiqikd
    snnvasfntnftfiiraknqsisayglafalvpvnsppqkkqeflgifntnnpepnartv
    avvfntfknridfdknfikpyvnencdfhkyngektdvqitydssnndlrvflhftvsqv
    kcsvsatvhlekevdewvsvgfsptsgltedttethdvlswsfsskfr