PDB entry 1io9

View 1io9 on RCSB PDB site
Description: thermophilic cytochrome p450 (cyp119) from sulfolobus solfataricus: high resolution structural origin of its thermostability and functional properties
Class: oxidoreductase
Keywords: Thermophilic, Cytochromo P450, Crystal Structure, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2001-02-08, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 cyp119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1io9a_
  • Chain 'B':
    Compound: cytochrome p450 cyp119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1io9b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1io9A (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1io9A (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1io9B (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1io9B (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvlgkkyleligyvkdhlnsgtevvsrvvns
    nlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenlylkaieealrysp
    pvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfipdrnpnphlsfgs
    gihlclgaplarleariaieefskrfrhieildtekvpnevlngykrlvvrlks