PDB entry 1io6

View 1io6 on RCSB PDB site
Description: growth factor receptor-bound protein 2 (grb2) c-terminal sh3 domain complexed with a ligand peptide (nmr, minimized mean structure)
Class: signaling protein
Keywords: signal transduction, sh3 domain, proline-rich peptide, complex (sh3 domain/peptide)
Deposited on 2001-01-25, released 2001-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-21, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (2-58)
      • cloning artifact (0-1)
    Domains in SCOP 1.75: d1io6a_
  • Chain 'B':
    Compound: a ligand peptide
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1io6A (A:)
    gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr
    

  • Chain 'B':
    No sequence available.