PDB entry 1io3

View 1io3 on RCSB PDB site
Description: crystal structure of ferricytochrome c2 from rhodopseudomonas viridis
Deposited on 2001-01-06, released 2001-04-18
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1io3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1io3A (A:)
  qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
  evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk