PDB entry 1io3

View 1io3 on RCSB PDB site
Description: crystal structure of ferricytochrome c2 from rhodopseudomonas viridis
Class: electron transport
Keywords: heme protein, electron transport
Deposited on 2001-01-06, released 2001-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c2
  Species: Blastochloris viridis [TaxId:1079]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00083 (0-106)
  Domains in SCOPe 2.08: d1io3a_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1io3A (A:)
  qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
  evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk