PDB entry 1io2

View 1io2 on RCSB PDB site
Description: crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Class: hydrolase
Keywords: endonuclease
Deposited on 2000-12-28, released 2001-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hii
    Species: Pyrococcus kodakaraensis
    Gene: rnhB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1io2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1io2A (A:)
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkiaekvesekk