PDB entry 1io2

View 1io2 on RCSB PDB site
Description: Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Deposited on 2000-12-28, released 2001-04-18
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1io2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1io2A (A:)
    mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
    ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
    rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
    enyyrehgefppivrkgwktlkkiaekvesekk