PDB entry 1io0

View 1io0 on RCSB PDB site
Description: crystal structure of tropomodulin c-terminal half
Class: protein binding
Keywords: LRR protein, right-handed super-helix, PROTEIN BINDING
Deposited on 2000-12-14, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.203
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tropomodulin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1io0a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1io0A (A:)
    glnsvikptkykpvpdeepnstdveetlkriqnndpdleevnlnnimnipvptlkacaea
    lktntyvkkfsivgtrsndpvafalaemlkvnntlkslnvesnfisgsgilalvealqsn
    tslielridnqsqplgnnvemeianmleknttllkfgyhftqqgprlrasnammnnndlv
    rkrrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1io0A (A:)
    nstdveetlkriqnndpdleevnlnnimnipvptlkacaealktntyvkkfsivgtrsnd
    pvafalaemlkvnntlkslnvesnfisgsgilalvealqsntslielridnqsqplgnnv
    emeianmleknttllkfgyhftqqgprlrasnammnnndlvrkrrl