PDB entry 1inz

View 1inz on RCSB PDB site
Description: solution structure of the epsin n-terminal homology (enth) domain of human epsin
Class: endocytosis/exocytosis
Keywords: ALPHA-HELIX, EPSIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2000-12-05, released 2001-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eps15-interacting portein(epsin)
    Species: Homo sapiens [TaxId:9606]
    Gene: EPSIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6I3 (4-147)
      • see remark 999 (0-3)
    Domains in SCOPe 2.07: d1inza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1inzA (A:)
    gssrmstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafsei
    msmiwkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdg
    kdqgvnvrekakqlvallrdedrlreer