PDB entry 1inz

View 1inz on RCSB PDB site
Description: solution structure of the epsin n-terminal homology (enth) domain of human epsin
Class: endocytosis/exocytosis
Keywords: ALPHA-HELIX, EPSIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2000-12-05, released 2001-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eps15-interacting protein(epsin)
  Species: Homo sapiens [TaxId:9606]
  Gene: EPSIN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y6I3 (4-147)
    • see remark 999 (0-3)
  Domains in SCOPe 2.08: d1inza1, d1inza2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1inzA (A:)
  gssrmstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafsei
  msmiwkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdg
  kdqgvnvrekakqlvallrdedrlreer