PDB entry 1inw

View 1inw on RCSB PDB site
Description: a sialic acid derived phosphonate analog inhibits different strains of influenza virus neuraminidase with different efficiencies
Class: hydrolase
Keywords: hydrolase, o-glycosyl, neuraminidase, sialidase
Deposited on 1994-09-26, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: influenza a subtype n2 neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06820 (0-387)
      • conflict (257)
    Domains in SCOPe 2.07: d1inwa_
  • Heterogens: NAG, AXP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1inwA (A:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi