PDB entry 1ino

View 1ino on RCSB PDB site
Description: recombinant inorganic pyrophosphatase from escherichia coli
Class: acid anhydride hydrolase
Keywords: metal binding, mn2+ ion, complex, acid anhydride hydrolase
Deposited on 1995-10-03, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1inoa_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1inoA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk