PDB entry 1inn

View 1inn on RCSB PDB site
Description: crystal structure of d. radiodurans luxs, p21
Class: signaling protein
Keywords: alpha-beta fold, SIGNALING PROTEIN
Deposited on 2001-05-14, released 2001-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRU8
      • cloning artifact (66)
      • cloning artifact (79)
      • cloning artifact (85)
      • cloning artifact (87)
      • cloning artifact (99)
    Domains in SCOPe 2.05: d1inna_
  • Chain 'B':
    Compound: autoinducer-2 production protein luxs
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRU8
      • cloning artifact (66)
      • cloning artifact (79)
      • cloning artifact (85)
      • cloning artifact (87)
      • cloning artifact (99)
    Domains in SCOPe 2.05: d1innb_
  • Heterogens: ZN, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1innA (A:)
    mpdmanvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtle
    hllagymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgv
    selecgnyrdhdlaaarqhardvldqglkvqetillergshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1innA (A:)
    nvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllag
    ymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselec
    gnyrdhdlaaarqhardvldqglkvqetill
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1innB (B:)
    mpdmanvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtle
    hllagymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgv
    selecgnyrdhdlaaarqhardvldqglkvqetillergshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1innB (B:)
    vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
    mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
    nyrdhdlaaarqhardvldqglkvqetill