PDB entry 1inl

View 1inl on RCSB PDB site
Description: Crystal Structure of Spermidine Synthase from Thermotoga Maritima
Class: transferase
Keywords: beta-barrel, Rossmann fold, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2001-05-14, released 2001-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1inla_
  • Chain 'B':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1inlb_
  • Chain 'C':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1inlc_
  • Chain 'D':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1inld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1inlA (A:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1inlA (A:)
    rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
    ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
    vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidslfteefyqac
    ydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgmwsytfask
    gidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1inlB (B:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1inlB (B:)
    rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
    ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
    vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptahlfte
    efyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgmws
    ytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1inlC (C:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1inlC (C:)
    lkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfald
    gitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevd
    glvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlf
    teefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgm
    wsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1inlD (D:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1inlD (D:)
    lkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfald
    gitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevd
    glvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidsfteefyqacyda
    lkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgmwsytfaskgid
    pikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm