PDB entry 1ini

View 1ini on RCSB PDB site
Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthetase (ygbp) involved in mevalonate independent isoprenoid biosynthesis, complexed with cdp-me and mg2+
Deposited on 2001-05-14, released 2001-11-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-14, with a file datestamp of 2001-11-14.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.222
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1inia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iniA (A:)
    thldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgds
    rfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllal
    setsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltraln
    egatitdeasaleycgfhpqlvegradnikvtrpedlalaefylt