PDB entry 1ini

View 1ini on RCSB PDB site
Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthetase (ygbp) involved in mevalonate independent isoprenoid biosynthesis, complexed with cdp-me and mg2+
Class: transferase
Keywords: ygbp, cytidylyltransferase, deoxyxylulose-5-phosphate pathway (dxp), isoprenoid biosynthesis, cdpme, mg, transferase
Deposited on 2001-05-14, released 2001-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.222
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-diphosphocytidyl-2-c-methylerythritol synthetase
    Species: Escherichia coli [TaxId:83333]
    Gene: ISPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1inia_
  • Heterogens: MG, CDM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iniA (A:)
    matthldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaisp
    gdsrfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarl
    lalsetsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltr
    alnegatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltrtihqent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iniA (A:)
    thldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgds
    rfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllal
    setsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltraln
    egatitdeasaleycgfhpqlvegradnikvtrpedlalaefylt