PDB entry 1inh

View 1inh on RCSB PDB site
Description: influenza a subtype n2 neuraminidase complexed with aromatic bana111 inhibitor
Class: hydrolase (o-glycosyl)
Keywords: neuraminidase, sialidase, hydrolase, o-glycosyl, hydrolase (o-glycosyl)
Deposited on 1995-07-07, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: influenza a subtype n2 neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06820 (0-387)
      • conflict (257)
    Domains in SCOPe 2.07: d1inha_
  • Chain 'B':
    Compound: influenza a subtype n2 neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06820 (0-387)
      • conflict (257)
    Domains in SCOPe 2.07: d1inhb_
  • Heterogens: NAG, CA, ST6

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1inhA (A:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1inhB (B:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi