PDB entry 1ing

View 1ing on RCSB PDB site
Description: influenza a subtype n2 neuraminidase complexed with aromatic bana109 inhibitor
Deposited on 1995-07-07, released 1996-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.163
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1inga_
  • Chain 'B':
    Domains in SCOP 1.55: d1ingb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ingA (A:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ingB (B:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi