PDB entry 1ine

View 1ine on RCSB PDB site
Description:
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOP 1.65 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ineh1, d1ineh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1inel1, d1inel2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ineH (H:)
    evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
    sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprdcgckpcictvpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ineH (H:)
    evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
    sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ineL (L:)
    eavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarewerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ineL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyl
    tltarewerhssyscqvtheghtvekslsra