PDB entry 1ind

View 1ind on RCSB PDB site
Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-lambda cha255 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38864 (1-End)
      • conflict (2)
      • conflict (4)
      • conflict (10)
      • conflict (26)
      • conflict (28)
      • conflict (30-32)
      • conflict (39)
      • conflict (41)
      • conflict (50-51)
      • conflict (55-56)
      • conflict (58)
      • conflict (60-61)
      • conflict (75)
      • conflict (77)
      • conflict (82-83)
      • conflict (86)
      • conflict (92)
      • conflict (94)
      • conflict (98)
      • conflict (101-102)
      • conflict (105)
      • conflict (170)
      • conflict (186-187)
    Domains in SCOPe 2.06: d1indh1, d1indh2
  • Chain 'L':
    Compound: igg1-lambda cha255 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (1-End)
      • conflict (86)
      • conflict (96)
      • conflict (139)
      • conflict (186)
    Domains in SCOPe 2.06: d1indl1, d1indl2
  • Heterogens: IN, EOT, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1indH (H:)
    evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
    sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprdcgckpcictvpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1indH (H:)
    evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
    sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1indL (L:)
    eavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarewerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1indL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyl
    tltarewerhssyscqvtheghtvekslsra