PDB entry 1in6

View 1in6 on RCSB PDB site
Description:
Deposited on 2001-05-12, released 2001-08-08
The last revision prior to the SCOP 1.65 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.234
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1in6a1, d1in6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1in6A (A:)
    msefltpertvydsgvqflrpksldefigqenvkkklslaleaakmrgevldhvllagpp
    glgrttlahiiaselqtnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkavee
    llysaiedfqidimigkgpsaksiridiqpftlvgattrsgllssplrsrfgiileldfy
    tvkelkeiikraaslmdveiedaaaemiakrsrgtpriairltkrvrdmltvvkadrint
    divlktmevlniddegldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepy
    llqagflartprgrivtekaykhlkyevpenrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1in6A (A:)
    qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgrttlahiiaselq
    tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqididiq
    pftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemia
    krsrgtpriairltkrvrdmltvvkadrintdivlktmevlniddegldefdrkilktii
    eiyrggpvglnalaaslgveadtlsevyepyllqagflartprgrivtekaykhlkyevp