PDB entry 1in4

View 1in4 on RCSB PDB site
Description: thermotoga maritima ruvb holliday junction branch migration motor
Class: DNA binding protein
Keywords: AAA+-Class ATPase, winged-helix domain, ATP hydrolysis, Walker A, Walker B, Sensor 1, Sensor 2, Arginine Finger, Holliday Junction, Branch Migration, DNA translocase, DNA BINDING PROTEIN
Deposited on 2001-05-12, released 2001-08-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.234
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction DNA helicase ruvb
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RUVB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1in4a1, d1in4a2
  • Heterogens: ACT, CO, ADP, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1in4A (A:)
    msefltpertvydsgvqflrpksldefigqenvkkklslaleaakmrgevldhvllagpp
    glgkttlahiiaselqtnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkavee
    llysaiedfqidimigkgpsaksiridiqpftlvgattrsgllssplrsrfgiileldfy
    tvkelkeiikraaslmdveiedaaaemiakrsrgtpriairltkrvrdmltvvkadrint
    divlktmevlniddegldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepy
    llqagflartprgrivtekaykhlkyevpenrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1in4A (A:)
    qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselq
    tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidiqpf
    tlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemiakr
    srgtpriairltkrvrdmltvvkadrintdivlktmevlniddegldefdrkilktiiei
    yrggpvglnalaaslgveadtlsevyepyllqagflartprgrivtekaykhlkyevp