PDB entry 1imx

View 1imx on RCSB PDB site
Description: 1.8 Angstrom crystal structure of IGF-1
Class: hormone/growth factor
Keywords: insulin/relaxin, detergent, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-05-11, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.245
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like Growth Factor 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1imxa_
  • Heterogens: BR, CPQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1imxA (A:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1imxA (A:)
    etlcgaelvdalqfvcgdrgfyfnkptgygsstgivdeccfrscdlrrlemycapl