PDB entry 1imu

View 1imu on RCSB PDB site
Description: Solution Structure of HI0257, a Ribosome Binding Protein
Class: RNA binding protein
Keywords: DSRNA BINDING PROTEIN, NMR, PROTEOME, SOLUTION STRUCTURE, ribosome, Structure 2 Function Project, S2F, Structural Genomics
Deposited on 2001-05-11, released 2001-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein hi0257
  Species: Haemophilus influenzae [TaxId:727]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P71346 (0-106)
  Domains in SCOPe 2.08: d1imua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1imuA (A:)
  mtlnitskqmditpairehleerlaklgkwqtqlisphfvlnkvpngfsveasigtplgn
  llasatsddmykaineveeklerqlnklqhksesrraderlkdsfen