PDB entry 1imd

View 1imd on RCSB PDB site
Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-02-08, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol monophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1imda_
  • Chain 'B':
    Compound: inositol monophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1imdb_
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1imdA (A:)
    madpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissike
    kypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefg
    vvyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnme
    klfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtg
    gpfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1imdA (A:)
    wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
    hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
    cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
    ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
    lmsrrviaannrilaeriakeiqvipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1imdB (B:)
    madpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissike
    kypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefg
    vvyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnme
    klfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtg
    gpfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1imdB (B:)
    wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
    hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
    cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
    ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
    lmsrrviaannrilaeriakeiqviplqrdded