PDB entry 1im4

View 1im4 on RCSB PDB site
Description: Crystal Structure of a DinB Homolog (DBH) Lesion Bypass DNA Polymerase Catalytic Fragment from Sulfolobus solfataricus
Class: transferase
Keywords: DNA polymerase palm, thumb, fingers, helix-hairpin-helix, fidelity, processivity, TRANSFERASE
Deposited on 2001-05-09, released 2001-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dbh
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: DBH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96022 (6-End)
      • expression tag (1-5)
    Domains in SCOPe 2.06: d1im4a1, d1im4a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1im4A (A:)
    hhhhhhivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgv
    kagmpiikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkv
    egnfengielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdf
    lneldideipgigsvlarrlnelgiqklrdilsknynelek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1im4A (A:)
    hhhhhivifvdfdyffaqveevlnpqykgkplvvcvystsgavatanyearklgvkagmp
    iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
    ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
    ideipgigsvlarrlnelgiqklrd