PDB entry 1im2

View 1im2 on RCSB PDB site
Description:
Deposited on 2001-05-09, released 2001-08-08
The last revision prior to the SCOP 1.61 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1im2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1im2A (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1im2A (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerliddeaaklinpeelkqkaidaveqngivfideidkickeysgadvsregv
    qrdllplvegstvstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsa
    adferiltephaslteqykalmategvniafttdavkkiaeaafrvnektenigarrlht
    vmerlmdkisfsasdmngqtvnidaayvadalgevvenedlsrfil