PDB entry 1im2

View 1im2 on RCSB PDB site
Description: HslU, Haemophilus Influenzae, Selenomethionine Variant
Class: chaperone
Keywords: chaperone, AAA family
Deposited on 2001-05-09, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43773 (Start-443)
      • modified residue (3)
      • modified residue (37)
      • modified residue (54)
      • modified residue (107)
      • modified residue (296)
      • modified residue (359)
      • modified residue (399)
      • modified residue (403)
      • modified residue (413)
    Domains in SCOPe 2.07: d1im2a_
  • Heterogens: SO4, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1im2A (A:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknr
    araedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsag
    vsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeel
    kqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvkt
    dhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalm
    ategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvn
    idaayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1im2A (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerliddeaaklinpeelkqkaidaveqngivfideidkickeysgadvsregv
    qrdllplvegstvstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsa
    adferiltephaslteqykalmategvniafttdavkkiaeaafrvnektenigarrlht
    vmerlmdkisfsasdmngqtvnidaayvadalgevvenedlsrfil