PDB entry 1ilu

View 1ilu on RCSB PDB site
Description: x-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Deposited on 1995-10-12, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ilua_
  • Chain 'B':
    Domains in SCOP 1.55: d1ilub_
  • Chain 'C':
    Domains in SCOP 1.55: d1iluc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ilud_
  • Chain 'E':
    Domains in SCOP 1.55: d1ilue_
  • Chain 'F':
    Domains in SCOP 1.55: d1iluf_
  • Chain 'G':
    Domains in SCOP 1.55: d1ilug_
  • Chain 'H':
    Domains in SCOP 1.55: d1iluh_
  • Chain 'I':
    Domains in SCOP 1.55: d1ilui_
  • Chain 'K':
    Domains in SCOP 1.55: d1iluk_
  • Chain 'L':
    Domains in SCOP 1.55: d1ilul_
  • Chain 'M':
    Domains in SCOP 1.55: d1ilum_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluE (E:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluF (F:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluG (G:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluH (H:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluI (I:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluK (K:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluL (L:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iluM (M:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
    mkgtltlk