PDB entry 1ils

View 1ils on RCSB PDB site
Description: x-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Deposited on 1995-10-12, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ilsa_
  • Chain 'B':
    Domains in SCOP 1.55: d1ilsb_
  • Chain 'C':
    Domains in SCOP 1.55: d1ilsc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ilsd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilsA (A:)
    aecsvdsqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilsB (B:)
    aecsvdsqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilsC (C:)
    aecsvdsqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilsD (D:)
    aecsvdsqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk