PDB entry 1ilq

View 1ilq on RCSB PDB site
Description: cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)
Deposited on 1998-12-17, released 1998-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ilqa_
  • Chain 'B':
    Domains in SCOP 1.55: d1ilqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilqA (A:)
    akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
    vekflkraens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilqB (B:)
    akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
    vekflkraens