PDB entry 1ilp

View 1ilp on RCSB PDB site
Description: cxcr-1 n-terminal peptide bound to interleukin-8
Class: cytokine
Keywords: cytokine
Deposited on 1998-12-16, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (interleukin-8 precursor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ilpa_
  • Chain 'B':
    Compound: protein (interleukin-8 precursor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ilpb_
  • Chain 'C':
    Compound: protein (interleukin-8 receptor)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25024 (0-16)
      • see remark 999 (6)
  • Heterogens: NH2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ilpA (A:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqr
    vvekflkraens
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ilpA (A:)
    akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
    vekflkraens
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ilpB (B:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqr
    vvekflkraens
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ilpB (B:)
    akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
    vekflkraens
    

  • Chain 'C':
    No sequence available.