PDB entry 1ilh

View 1ilh on RCSB PDB site
Description: Crystal Structure of Human Pregnane X Receptor Ligand Binding Domain Bound to SR12813
Class: gene regulation
Keywords: nuclear receptor, multiple binding modes, xenobiotic, promiscuous, ligand, GENE REGULATION
Deposited on 2001-05-08, released 2001-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orphan nuclear receptor pxr
    Species: Homo sapiens [TaxId:9606]
    Gene: PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ilha_
  • Heterogens: SRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ilhA (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ilhA (A:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvkwsqvrkdlcslkvslqlrgedgs
    vwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllkgaaf
    elcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyv
    lmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelr
    sinaqhtqrllriqdihpfatplmqelfgi