PDB entry 1ile

View 1ile on RCSB PDB site
Description: isoleucyl-trna synthetase
Deposited on 1998-02-24, released 1999-04-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-13, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ile_ (-)
    mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa
    rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr
    esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy
    cprcgtplsshevalgykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaa
    avhpeytyaafqvgdealileeglgrkllgegtqvlktfpgkaleglpytppypqalekg
    yfvvladyvsqedgtgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfr
    eanrailrdlrgrgllfkeesylhsyphcwrcstplmyyateswfikntlfkdelirnnq
    eihwvpphikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkara
    tkplpepfdphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfr
    esfpadfiaegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvv
    dpwdiirkfgadalrwyiyvsappeadrrfgpnlvretvrdyfltlwnvysffvtyanld
    rpdlknppppekrpemdrwllarmqdliqrvtealeaydpttsaralrdfvvedlsqwyv
    rrnrrrfwknedaldreaayatlyealvlvatlaapftpflaevlwqnlvrsvrleakes
    vhladwpeadpaladealvaqmravlkvvdlaraaraksgv