PDB entry 1ile

View 1ile on RCSB PDB site
Description: isoleucyl-tRNA synthetase
Class: aminoacyl-tRNA synthetase
Keywords: AMINOACYL-TRNA SYNTHETASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 1998-02-24, released 1999-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ilea1, d1ilea2, d1ilea3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ileA (A:)
    mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa
    rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr
    esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy
    cprcgtplsshevalgykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaa
    avhpeytyaafqvgdealileeglgrkllgegtqvlktfpgkaleglpytppypqalekg
    yfvvladyvsqedgtgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfr
    eanrailrdlrgrgllfkeesylhsyphcwrcstplmyyateswfikntlfkdelirnnq
    eihwvpphikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkara
    tkplpepfdphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfr
    esfpadfiaegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvv
    dpwdiirkfgadalrwyiyvsappeadrrfgpnlvretvrdyfltlwnvysffvtyanld
    rpdlknppppekrpemdrwllarmqdliqrvtealeaydpttsaralrdfvvedlsqwyv
    rrnrrrfwknedaldreaayatlyealvlvatlaapftpflaevlwqnlvrsvrleakes
    vhladwpeadpaladealvaqmravlkvvdlaraaraksgv