PDB entry 1il8

View 1il8 on RCSB PDB site
Description: three-dimensional structure of interleukin 8 in solution
Deposited on 1990-03-08, released 1991-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1il8a_
  • Chain 'B':
    Domains in SCOP 1.55: d1il8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il8A (A:)
    akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
    vekflkraens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il8B (B:)
    akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
    vekflkraens