PDB entry 1il6

View 1il6 on RCSB PDB site
Description: human interleukin-6, nmr, minimized average structure
Deposited on 1997-01-31, released 1998-02-04
The last revision prior to the SCOP 1.59 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1il6__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il6_ (-)
    ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
    neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
    pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm