PDB entry 1il2

View 1il2 on RCSB PDB site
Description: Crystal Structure of the E. coli Aspartyl-tRNA Synthetase:Yeast tRNAasp:aspartyl-Adenylate Complex
Class: ligase/RNA
Keywords: protein-rna complex, LIGASE/RNA COMPLEX
Deposited on 2001-05-07, released 2001-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1il2a1, d1il2a2, d1il2a3
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1il2b1, d1il2b2, d1il2b3
  • Chain 'C':
    Compound: aspartyl transfer RNA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
  • Chain 'D':
    Compound: aspartyl transfer RNA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
  • Heterogens: SO4, AMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1il2A (A:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvkkaenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1il2A (A:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1il2B (B:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvkkaenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1il2B (B:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.