PDB entry 1il1

View 1il1 on RCSB PDB site
Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody
Deposited on 2001-05-07, released 2001-05-16
The last revision prior to the SCOP 1.69 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il1A (A:)
    qlqqsgaelvrsgasvklscatsdfnikdyyihwvrqrpeqglewigwldpengdtesap
    kfqgkatmtadtssntaylqlssltseasavyycnaisttrdyyaldywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il1B (B:)
    divmsqspsslavsvgekvtmsckssqsllysrnqmnylswyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyyhyrtfgggtrleirradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec