PDB entry 1il1

View 1il1 on RCSB PDB site
Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody
Class: immune system
Keywords: Fab, beta sheet structure, antibody, IMMUNE SYSTEM
Deposited on 2001-05-07, released 2001-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody G3-519 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IL1 (0-218)
    Domains in SCOPe 2.07: d1il1a1, d1il1a2
  • Chain 'B':
    Compound: monoclonal antibody G3-519 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IL1 (0-218)
    Domains in SCOPe 2.07: d1il1b1, d1il1b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il1A (A:)
    qlqqsgaelvrsgasvklscatsdfnikdyyihwvrqrpeqglewigwldpengdtesap
    kfqgkatmtadtssntaylqlssltseasavyycnaisttrdyyaldywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1il1B (B:)
    divmsqspsslavsvgekvtmsckssqsllysrnqmnylswyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyyhyrtfgggtrleirradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec