PDB entry 1il0

View 1il0 on RCSB PDB site
Description: x-ray crystal structure of the e170q mutant of human l-3-hydroxyacyl-coa dehydrogenase
Class: oxidoreductase
Keywords: abortive ternary complex, oxidoreductase
Deposited on 2001-05-07, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HCDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (169)
    Domains in SCOPe 2.07: d1il0a1, d1il0a2
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HCDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (169)
    Domains in SCOPe 2.07: d1il0b1, d1il0b2
  • Heterogens: CAA, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1il0A (A:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklvqviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1il0A (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklvqviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1il0B (B:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklvqviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1il0B (B:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklvqviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk