PDB entry 1ikz

View 1ikz on RCSB PDB site
Description: solution structure of the catalytic domain of mapk phosphatase pac-1: insights into substrate-induced enzymatic activation
Deposited on 2001-05-07, released 2002-05-30
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-30, with a file datestamp of 2002-05-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1ikza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ikzA (A:)
  pveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqmvei
  sawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkqrrg
  vispnfsfmgqllqfetqvlch