PDB entry 1ikv

View 1ikv on RCSB PDB site
Description: k103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Deposited on 2001-05-07, released 2001-06-06
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ikvA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ikvA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkksvtvldvgdayfsvpld
    edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviy
    qymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtv
    qpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeael
    elaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgah
    tndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpp
    lvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlqa
    iylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkg
    iggneqvdklvsagir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ikvB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ikvB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkksvtvldvgdayfsvpldedfr
    kytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymd
    dlyvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvndiq
    klvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvy
    ydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviw
    gktpkfklpiqketwetwwteywqatwipewefvntpplvklwy