PDB entry 1iko

View 1iko on RCSB PDB site
Description: crystal structure of the murine ephrin-b2 ectodomain
Class: signaling protein
Keywords: greek key, glycosylation, signaling protein
Deposited on 2001-05-03, released 2002-05-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: ephrin-b2
    Species: Mus musculus [TaxId:10090]
    Gene: ephrin-B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ikop_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ikoP (P:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqdassagsarnhgptrrpeleagtngrssttspfvkpnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ikoP (P:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqd