PDB entry 1ikm

View 1ikm on RCSB PDB site
Description: NMR study of monomeric human interleukin-8 (30 structures)
Class: cytokine (chemotactic)
Keywords: cytokine (chemotactic)
Deposited on 1995-08-03, released 1995-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human interleukin-8 (monomeric)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ikma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ikmA (A:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqr
    vvekflkraens
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ikmA (A:)
    elrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvve
    kflkraens