PDB entry 1ikl

View 1ikl on RCSB PDB site
Description: NMR study of monomeric human interleukin-8 (minimized average structure)
Deposited on 1995-08-03, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ikl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikl_ (-)
    elrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvve
    kflkraens