PDB entry 1ikh

View 1ikh on RCSB PDB site
Description: crystal structure of nitrophorin 4 from rhodnius prolixus complexed with nitric oxide at 1.08 a resolution
Class: transport protein
Keywords: nitric oxide transport, ferric heme, anithistimine, lipocalin
Deposited on 2001-05-03, released 2001-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-06-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.117
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ikha_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikhA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk