PDB entry 1ikf

View 1ikf on RCSB PDB site
Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Deposited on 1993-12-09, released 1995-03-31
The last revision prior to the SCOP 1.69 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.164
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikfH (H:)
    evklvesggglvqpggslklscatsgftfsdyymywvrqnsekrlewvafisngggsafy
    adivkgrftisrdnakntlylqmsrlksedtamyyctrhtlydtlygnypvwfadwgqgt
    lvtvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpsssrpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikfL (L:)
    diqmtqttsslsaslgdrvtiscrasqdistylnwyqqkpdgtvkllifytsrlrsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgsripptfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnraac