PDB entry 1ikf

View 1ikf on RCSB PDB site
Description:
Deposited on 1993-12-09, released 1995-03-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.164
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1ikfh1, d1ikfh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1ikfl1, d1ikfl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikfH (H:)
    evklvesggglvqpggslklscatsgftfsdyymywvrqnsekrlewvafisngggsafy
    adivkgrftisrdnakntlylqmsrlksedtamyyctrhtlydtlygnypvwfadwgqgt
    lvtvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpsssrpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikfL (L:)
    diqmtqttsslsaslgdrvtiscrasqdistylnwyqqkpdgtvkllifytsrlrsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgsripptfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnraac